PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G118600.1.p
Common NameLOC101770839, SETIT_007873mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 311aa    MW: 35191.4 Da    PI: 7.4996
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G118600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.4e-12136179447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         WT+eE+ +++ + + +G g+Wk I+r+    +t+ q+ s+ qky
  Seita.4G118600.1.p 136 WTEEEHRQFLYGLRAYGRGNWKIISRHYVPSKTPVQISSHAQKY 179
                         ****************************99*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.543128184IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-9129182IPR009057Homeodomain-like
SMARTSM007171.1E-9132182IPR001005SANT/Myb domain
SuperFamilySSF466892.8E-15132185IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-13135182IPR006447Myb domain, plants
CDDcd001671.89E-10136180No hitNo description
PfamPF002496.5E-9136179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MDPRFNGEWR ASEIQTVKSL IARHNTNNNH ANNMNKKHTD IVDELQAMFP LKEKHQVTNL  60
YVELMVEIIQ SGNQHVATSS NLMNGNFGMP MEDPAMGNME EVLCSSLMEE MGAMRKGEEA  120
LQKQPTLRKQ HAARFWTEEE HRQFLYGLRA YGRGNWKIIS RHYVPSKTPV QISSHAQKYF  180
QRLQNPTKKQ RYSINDVGLY EAEPRVQNNA SGQERLTFAR GAYNPNHYGS GGQPTAMNNL  240
PKVRLPLPHI TSQASSSQAA TLATGHQQQM EANGSFVAPS VEGDGSHMAW TSDQQGEFLD  300
NQWFMDLRMD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966889.10.0PREDICTED: myb-like protein H
TrEMBLK3Y1110.0K3Y111_SETIT; Uncharacterized protein
STRINGSi007873m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.25e-20MYB family protein